FOX-04: 10mg
FOX-04 is a lab-made peptide studied in cellular-aging research, specifically around aging ("senescent") cells. Researchers study its role in aging-cell (senescence) pathways. Sold for research and laboratory use only — not for human or veterinary use.
Ships same day from California on orders placed before 2PM PST · UPS Priority, 1–3 days
Independently lab tested Independently verified See lab tests ›Freeze-dried powder, not liquid
Peptides are required to be reconstituted before research use.
About This Product
FOX-04 (FOXO4-DRI) is studied under senolytic peptide research, carrying CAS 2460055-10-9, molecular formula C228H388N86O64, a molecular weight of 5358.06, a 34-residue sequence. Warrior Makers supplies it as a lyophilized powder preparation, with third-party HPLC/LC-MS identity testing and a Certificate of Analysis on every batch.
What is FOX-04?
FOX-04 is a lab-made peptide studied in cellular-aging research, specifically around aging (“senescent”) cells.
What Does FOX-04 Do?
Researchers study how FOX-04 disrupts a specific protein interaction inside aging cells, a pathway of interest in cellular-senescence research.
Is FOX-04 Safe to Use?
FOX-04 hasn’t been evaluated by the FDA, and there’s no established safety data for use in humans. This product is intended for research and laboratory use only — not for human or veterinary use, and not for diagnosing, treating, or preventing any disease.
Where to Buy FOX-04?
You can buy FOX-04 directly at Warrior Makers here, backed by third-party lab tests and Certificate of Analysis (COA) availability. Manufactured under controlled conditions and intended strictly for research and laboratory use.
Frequently Asked Questions
Is FOX-04 FDA approved?
No — FOX-04 isn’t approved by the FDA and is sold strictly for research use.
How does FOX-04 ship?
As a freeze-dried powder that needs to be mixed with bacteriostatic water before lab use.
How should FOX-04 be stored?
As an unreconstituted, freeze-dried powder, it should be stored in a cool, dry place away from direct light prior to laboratory use.
This product is intended for research purposes and laboratory use only.
Not for human or veterinary use. Not intended for consumption, diagnosis, treatment, or prevention of any disease.
Certificate of Analysis (COA)
This lot was analyzed by an independent third-party laboratory. Every panel below is published exactly as the lab reported it.
- Testing Laboratory
- Liquilabs
- Identity
- Passed
- Purity
- Passed
- Endotoxin
- Passed
- Sterility
- Passed
Specifications
- Product Name
- FOX-04 (FOXO4-DRI)
- Research Category
- Senolytic Peptide Research
- Available Contents (mg, mcg)
- 10mg
- Physical Form
- Lyophilized Powder
- Solubility
- Soluble in bacteriostatic water
- CAS Number
- 2460055-10-9
- Molecular Formula
- C228H388N86O64
- Molecular Weight (g/mol)
- 5358.06
- Amino Acid Count
- 34
- Amino Acid Sequence
- D-retro-inverso peptide: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids, reversed sequence)
- Purity Documentation
- Certificate of Analysis (COA)
- Identity Testing
- HPLC / LC-MS
- Purity
- 99%+ (HPLC Verified)
- Storage Conditions
- Refrigerated (2-8°C)
- Shipping
- Thermal-Packed via UPS
- Shelf Life
- 24 months from manufacturing
- Intended Use
- RESEARCH USE ONLY
What researchers are saying
No reviews have been left for this product yet.
Shipping & Handling
You May Also Like
Legal Disclaimer: For research purposes only. Not intended for consumption, clinical application, or diagnostic use. The buyer assumes full responsibility for appropriate handling, usage, and adherence to all relevant laws and regulations.
Write a Review
